PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn234051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 327aa    MW: 36995.2 Da    PI: 6.2539
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn234051genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2050105156
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 r+k +++t++q++eLe++F++n++p+++er eL k+l+L+ +q+k+WFqNrR+++k
  Achn234051  50 RKKYHRHTPYQIQELEAYFKMNNHPDEKERLELGKRLSLESKQIKFWFQNRRTQMK 105
                 7999*************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2136105IPR009057Homeodomain-like
SuperFamilySSF466892.52E-2038105IPR009057Homeodomain-like
PROSITE profilePS5007117.4147107IPR001356Homeobox domain
SMARTSM003891.3E-1649111IPR001356Homeobox domain
CDDcd000861.42E-1750105No hitNo description
PfamPF000463.8E-1850105IPR001356Homeobox domain
PROSITE profilePS5084812.695278326IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEGQSHVALM GGDFNPSLVA RIEEDGNESD RLEGASGDDQ DAAGNKHPRR KKYHRHTPYQ  60
IQELEAYFKM NNHPDEKERL ELGKRLSLES KQIKFWFQNR RTQMKVSIFR FSLFMKCDLL  120
VLSYGTEISL FNQTQTERHE NNYLKRQNEE LLIENIRMKE VMGNPMCCNC GGPAILGEVS  180
IEKHHLRVEN ARLKEELNRI SALANRFLGR PISSFAGLVH PPMSNTSLEL AVGINGFSGL  240
SSVNTTFPIG LDSKDGILNT LPGMPLVPPP PTGIARNEPF EKSIFLELAL RAMDELVKLA  300
QMDDPLWIRS LDGGREVLNE EEYMKI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320755.11e-114homeodomain family protein
RefseqXP_011035097.11e-114PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9IC551e-114B9IC55_POPTR; Homeodomain family protein
STRINGPOPTR_0014s07130.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13886814
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-85HD-ZIP family protein